PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00455_0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 671aa    MW: 71926.8 Da    PI: 6.0278
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00455_0010genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-1473117247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g W++eEd ll ++vk++G ++W+ I+  m  gR++k+c++rw + 
    kfl00455_0010  73 GWWSPEEDNLLSRLVKKFGARNWHFISPVMA-GRSAKSCRLRWCNQ 117
                      55*****************************.***********985 PP

2Myb_DNA-binding54.33e-17125168247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+eEd+++++a++ +G++ W+tIa+ ++ gRt++ +k+++++ 
    kfl00455_0010 125 RPFTAEEDDIILQAHTVHGNK-WATIAKLLP-GRTDNAVKNHFNSI 168
                      69*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.9964161IPR017877Myb-like domain
PROSITE profilePS5129416.00967118IPR017930Myb domain
SMARTSM007171.9E-1371120IPR001005SANT/Myb domain
SuperFamilySSF466891.73E-2972165IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2275125IPR009057Homeodomain-like
CDDcd001677.75E-1475116No hitNo description
PfamPF139211.8E-1475132No hitNo description
PROSITE profilePS5129423.891119173IPR017930Myb domain
SMARTSM007174.1E-15123171IPR001005SANT/Myb domain
CDDcd001672.75E-11126169No hitNo description
Gene3DG3DSA:1.10.10.606.3E-23126171IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MASSAAAEDI RDGQVKVPTE NQRARWTESQ IRWAVLAQEG WTDEDEKELQ RLAQSVAKWR  60
KYMGSPDGVE VKGWWSPEED NLLSRLVKKF GARNWHFISP VMAGRSAKSC RLRWCNQLNP  120
DVEKRPFTAE EDDIILQAHT VHGNKWATIA KLLPGRTDNA VKNHFNSILR RTKTEERRTQ  180
RLLDGRSSGP DGRSVSPRGS RRSAASDHSG HPYSATTQEL SEGPPPRGNH ALLDLNEPPA  240
ADNYESGPES SNVGGARDCS DRRGREGSVQ DTENCGDSIG VTKGFRTGVS EEGRAESSDV  300
EQVALAACRL EERSVGKRNR RRGDGDSGDR RGGSTGNLGP DLREESAECE GERALKIARV  360
GFPETAGELA SDGSPRFSSV SPGGEDTAPQ QTRSGSRQGL SLLRTGQVAQ AHAQVQGERG  420
SDPESPTFLQ LGRGPAFGTL AEKAVSGREA AASVPVALSF GGGIAIGPGW PQMPSGPFSL  480
PVPPERSAML DAPFRGDNGG GAGDPQPLLC KPYPYPAAAV SQLGGMDCGY GPPVPVLGPV  540
NPEVNPPAKS ELGQSHSSLL ETGRANSLLM GWASQLQETG QHKQVNDSMV AEMSELFGRL  600
AQGGAAFQQL WCPPGQHPLW LMTPAAQQQY LASLLQPGAV AFPQQGLNPA FLPPNPLAYQ  660
VPALWPPTED P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-33641711106B-MYB
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-40myb domain protein 1